CDS

Accession Number TCMCG063C18031
gbkey CDS
Protein Id KAF7818394.1
Location join(4193247..4193390,4195329..4195397,4196693..4196786,4197075..4197151)
Organism Senna tora
locus_tag G2W53_023849

Protein

Length 127aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA605066, BioSample:SAMN14013601
db_source JAAIUW010000008.1
Definition signal recognition particle 9 kDa protein [Senna tora]
Locus_tag G2W53_023849

EGGNOG-MAPPER Annotation

COG_category U
Description Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding
KEGG_TC 3.A.5.9
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko02044        [VIEW IN KEGG]
KEGG_ko ko:K03109        [VIEW IN KEGG]
EC -
KEGG_Pathway ko03060        [VIEW IN KEGG]
map03060        [VIEW IN KEGG]
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0005047        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005783        [VIEW IN EMBL-EBI]
GO:0005785        [VIEW IN EMBL-EBI]
GO:0005786        [VIEW IN EMBL-EBI]
GO:0005789        [VIEW IN EMBL-EBI]
GO:0005791        [VIEW IN EMBL-EBI]
GO:0006605        [VIEW IN EMBL-EBI]
GO:0006612        [VIEW IN EMBL-EBI]
GO:0006613        [VIEW IN EMBL-EBI]
GO:0006614        [VIEW IN EMBL-EBI]
GO:0006616        [VIEW IN EMBL-EBI]
GO:0006810        [VIEW IN EMBL-EBI]
GO:0006886        [VIEW IN EMBL-EBI]
GO:0008104        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0015031        [VIEW IN EMBL-EBI]
GO:0015833        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0030867        [VIEW IN EMBL-EBI]
GO:0031090        [VIEW IN EMBL-EBI]
GO:0031984        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0033036        [VIEW IN EMBL-EBI]
GO:0033365        [VIEW IN EMBL-EBI]
GO:0034613        [VIEW IN EMBL-EBI]
GO:0042175        [VIEW IN EMBL-EBI]
GO:0042886        [VIEW IN EMBL-EBI]
GO:0043021        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044425        [VIEW IN EMBL-EBI]
GO:0044432        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0044877        [VIEW IN EMBL-EBI]
GO:0045047        [VIEW IN EMBL-EBI]
GO:0045184        [VIEW IN EMBL-EBI]
GO:0046907        [VIEW IN EMBL-EBI]
GO:0048500        [VIEW IN EMBL-EBI]
GO:0051179        [VIEW IN EMBL-EBI]
GO:0051234        [VIEW IN EMBL-EBI]
GO:0051641        [VIEW IN EMBL-EBI]
GO:0051649        [VIEW IN EMBL-EBI]
GO:0055085        [VIEW IN EMBL-EBI]
GO:0065002        [VIEW IN EMBL-EBI]
GO:0070727        [VIEW IN EMBL-EBI]
GO:0070972        [VIEW IN EMBL-EBI]
GO:0071702        [VIEW IN EMBL-EBI]
GO:0071705        [VIEW IN EMBL-EBI]
GO:0071806        [VIEW IN EMBL-EBI]
GO:0072594        [VIEW IN EMBL-EBI]
GO:0072599        [VIEW IN EMBL-EBI]
GO:0072657        [VIEW IN EMBL-EBI]
GO:0090150        [VIEW IN EMBL-EBI]
GO:0098588        [VIEW IN EMBL-EBI]
GO:0098796        [VIEW IN EMBL-EBI]
GO:0098827        [VIEW IN EMBL-EBI]
GO:1990904        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGCGGGAGACGACGTCTTGTCGATCGGATAGGGAAGTTGAAGGTGGAAGTAAGGGTGAGAGAGAATGTGTTCCAGACGCCTGCTATGGAAGTGGCGGCCACCAGGACTGGAAGGAGGCATATTCAACATTCAACAATAATATTACGCGGTATGTCATGAAGTACAGGCACTGTGATGGCAAATTGGTCCTCAAGGTCTCCGATAATCGAGAGTGTCTGAAGTATAAGACTGACCAAGCACAAGAGGCTAAGAAGATGGAGAAACTTAATAATATATTTTTTACTTTGATGGCTCGAGGACCTGAAGTGGATCTATCAGAAGTCACTGGAAAAGAACAAATGGAGGCACAACCAATCAAAAAAGGAAGAGGAAGGAAGCAATGA
Protein:  
MRETTSCRSDREVEGGSKGERECVPDACYGSGGHQDWKEAYSTFNNNITRYVMKYRHCDGKLVLKVSDNRECLKYKTDQAQEAKKMEKLNNIFFTLMARGPEVDLSEVTGKEQMEAQPIKKGRGRKQ